Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TEX10 Peptide - middle region

TEX10 Peptide - middle region

Product Specifications

UniProt

B7Z9D5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TEX10 Rabbit Polyclonal Antibody (orb325391) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RLTSQQWRLKVLVRLSKFLQALADGSSRLRESEGLQEQKENPHATSNSIF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-AKT (Ser473) (9H11) Monoclonal Antibody, APC Conjugated
bsm-33281M-APC-TR 20 µL

Phospho-AKT (Ser473) (9H11) Monoclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
Mouse Monoclonal LDAH Antibody (OTI2G9) [mFluor Violet 500 SE]
NBP2-72122MFV500 0.1 mL

Mouse Monoclonal LDAH Antibody (OTI2G9) [mFluor Violet 500 SE]

Sign In for Pricing
View Details
Recombinant Mycoplasma agalactiae Peptide chain release factor 1 (prfA)
MBS1001957-01 0.02 mg (E-Coli)

Recombinant Mycoplasma agalactiae Peptide chain release factor 1 (prfA)

Sign In for Pricing
View Details
Recombinant Mycoplasma agalactiae Peptide chain release factor 1 (prfA)
MBS1001957-02 0.02 mg (Yeast)

Recombinant Mycoplasma agalactiae Peptide chain release factor 1 (prfA)

Sign In for Pricing
View Details
Recombinant Mycoplasma agalactiae Peptide chain release factor 1 (prfA)
MBS1001957-03 0.1 mg (E-Coli)

Recombinant Mycoplasma agalactiae Peptide chain release factor 1 (prfA)

Sign In for Pricing
View Details
Recombinant Mycoplasma agalactiae Peptide chain release factor 1 (prfA)
MBS1001957-04 0.1 mg (Yeast)

Recombinant Mycoplasma agalactiae Peptide chain release factor 1 (prfA)

Sign In for Pricing
View Details