Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LIPT2 Peptide - C-terminal region

LIPT2 Peptide - C-terminal region

Product Specifications

UniProt

A6NK58

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LIPT2 Rabbit Polyclonal Antibody (orb580685) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001138341

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TDLTWFEHIVPCGLVGTGVTSLSKELQRHVTVEEVMPPFLVAFKEIYKCT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OASA06821-1MG - Rat IgM Antibody - Biotin Conjugated
OASA06821-1MG 1 mg

OASA06821-1MG - Rat IgM Antibody - Biotin Conjugated

Sign In for Pricing
View Details
Anti-Calnexin/CANX Antibody Picoband®, Cy3 Conjugate
A03372-2-Cy3 100 µg/Vial

Anti-Calnexin/CANX Antibody Picoband®, Cy3 Conjugate

Sign In for Pricing
View Details
PR3 (PRTN3) (NM_002777) Human Over-expression Lysate
LC400985 20 µg

PR3 (PRTN3) (NM_002777) Human Over-expression Lysate

Sign In for Pricing
View Details
FGF8 Antibody
A21930-50UG 50 µg

FGF8 Antibody

Sign In for Pricing
View Details
Recombinant FAM219A Antibody
RN-12880-01 50 μL

Recombinant FAM219A Antibody

Sign In for Pricing
View Details
Recombinant FAM219A Antibody
RN-12880-02 100 µL

Recombinant FAM219A Antibody

Sign In for Pricing
View Details