LIPT2 Peptide - C-terminal region
LIPT2 Peptide - C-terminal region
Product Specifications
UniProt
A6NK58
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with LIPT2 Rabbit Polyclonal Antibody (orb580685) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001138341
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: TDLTWFEHIVPCGLVGTGVTSLSKELQRHVTVEEVMPPFLVAFKEIYKCT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb1046674 100 µL
Histone H3 (tri methyl K36) Rabbit Polyclonal Antibody (Cy7)
Sign In for Pricing
View Details 
MBS6383589-01 0.1 mL
KIR2DL4 (CD158D, KIR103AS, Killer Cell Immunoglobulin-like Receptor 2DL4, CD158 Antigen-like Family Member D, G9P, Killer Cell Inhibitory Receptor 103AS, MHC Class I NK Cell Receptor KIR103AS, CD158d) (FITC)
Sign In for Pricing
View Details