Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LIPT2 Peptide - C-terminal region

LIPT2 Peptide - C-terminal region

Product Specifications

UniProt

A6NK58

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LIPT2 Rabbit Polyclonal Antibody (orb580689) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001138341

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KICAIGVRCGRHITSHGLALNCSTDLTWFEHIVPCGLVGTGVTSLSKELQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CD252/TNFSF4/OX40L Protein, C-His
AP95422 50 µg

Recombinant Human CD252/TNFSF4/OX40L Protein, C-His

Sign In for Pricing
View Details
HoxB9 (H-8) Alexa Fluor® 488
sc-398500 AF488 200 µg/mL

HoxB9 (H-8) Alexa Fluor® 488

Sign In for Pricing
View Details
PIC 319-TRI 200-B7527 Electrical & Equipment Safety Signs (No Adhesive)
252238 1 Card (1 Panel (s) x 1 Pack)

PIC 319-TRI 200-B7527 Electrical & Equipment Safety Signs (No Adhesive)

Sign In for Pricing
View Details
LOC688235 3'UTR GFP Stable Cell Line
TU261660 1.0 mL

LOC688235 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
CCDC103 Protein Vector (Rat) (pPM-C-His)
PV257817 500 ng

CCDC103 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Ethyl 4- (2-hydroxyethyl) picolinate
OR1048949-01 100 mg

Ethyl 4- (2-hydroxyethyl) picolinate

Sign In for Pricing
View Details