Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LIPT2 Peptide - C-terminal region

LIPT2 Peptide - C-terminal region

Product Specifications

UniProt

A6NK58

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LIPT2 Rabbit Polyclonal Antibody (orb580689) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001138341

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KICAIGVRCGRHITSHGLALNCSTDLTWFEHIVPCGLVGTGVTSLSKELQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ttbk2 (NM_001024856) Mouse Tagged ORF Clone Lentiviral Particle
MR216471L3V 200 µL

Ttbk2 (NM_001024856) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
ARPC5L Polyclonal Antibody
RD252815A-01 20 µL

ARPC5L Polyclonal Antibody

Sign In for Pricing
View Details
ARPC5L Polyclonal Antibody
RD252815A-02 60 μL

ARPC5L Polyclonal Antibody

Sign In for Pricing
View Details
ARPC5L Polyclonal Antibody
RD252815A-03 120 μL

ARPC5L Polyclonal Antibody

Sign In for Pricing
View Details
ARPC5L Polyclonal Antibody
RD252815A-04 200 µL

ARPC5L Polyclonal Antibody

Sign In for Pricing
View Details
MASP2 Mouse Monoclonal Antibody [Clone ID: OTI4D4]
TA812529 100 µL

MASP2 Mouse Monoclonal Antibody [Clone ID: OTI4D4]

Sign In for Pricing
View Details