Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zfp84 Peptide - C-terminal region

Zfp84 Peptide - C-terminal region

Product Specifications

UniProt

D3ZD53

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Zfp84 Rabbit Polyclonal Antibody (orb325605) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001100970

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YECHKCQKAFNKSANLTRHQRIHSGEKPYECNLCGKTFTWASNLNDHQKI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human RETREG2 activation kit by CRISPRa
GA112377 1 Kit

Human RETREG2 activation kit by CRISPRa

Sign In for Pricing
View Details
Monobenzyl Malonate
TRC-M524880-1G 1 g

Monobenzyl Malonate

Sign In for Pricing
View Details
Themis3 Mouse Gene Knockout Kit (CRISPR)
KN517527 1 Kit

Themis3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human Nuclear Antigen (235-1), CF568 conjugate, 0.1mg/mL
BNC680099-500 1x 500 µL

Human Nuclear Antigen (235-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PHA-793887
TRC-P294480-10MG 10 mg

PHA-793887

Sign In for Pricing
View Details
ZBTB17 Antibody
KC-3682-01 50 μL

ZBTB17 Antibody

Sign In for Pricing
View Details