Zfp84 Peptide - C-terminal region
Zfp84 Peptide - C-terminal region
Product Specifications
UniProt
D3ZD53
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Zfp84 Rabbit Polyclonal Antibody (orb325605) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001100970
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: YECHKCQKAFNKSANLTRHQRIHSGEKPYECNLCGKTFTWASNLNDHQKI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TP303746M 100 µg
U1SNRNPBP (SNRNP35) (NM_180699) Human Recombinant Protein
Sign In for Pricing
View Details ![Tlr2 Rabbit Monoclonal Antibody [Clone ID: R06-8B6]](https://cdn.genprice.uk/products/937/6868c2cf994c49e6dc3e7a3d/imageurl/ta385414.webp)
TA385414 100 µL
Tlr2 Rabbit Monoclonal Antibody [Clone ID: R06-8B6]
Sign In for Pricing
View Details 
LC401175 20 µg
Frizzled 5 (FZD5) (NM_003468) Human Over-expression Lysate
Sign In for Pricing
View Details