PEG10 Peptide - C-terminal region
PEG10 Peptide - C-terminal region
Product Specifications
Product Name Alternative
EDR, HB-1, MEF3L, Mar2, Mart2, RGAG3
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PEG10 Rabbit Polyclonal Antibody (orb581339) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001165909
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RKPRSPPRALVLPHIASHHQVDPTEPVGGARMRLTQEEKERRRKLNLCLY
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
KN417443 1 Kit
Bile Acid Receptor (NR1H4) Human Gene Knockout Kit (CRISPR)
Sign In for Pricing
View Details 
LC431563 20 µg
Myocardin (MYOCD) (NM_001146313) Human Over-expression Lysate
Sign In for Pricing
View Details 
TP327852M 100 µg
SKIP (INPP5K) (NM_001135642) Human Recombinant Protein
Sign In for Pricing
View Details ![PRELID2 Mouse Monoclonal Antibody [Clone ID: OTI8F1]](https://cdn.genprice.uk/products/937/68dd18bb061270361e90897e/imageurl/cf810806.webp)
CF810806 100 µg
PRELID2 Mouse Monoclonal Antibody [Clone ID: OTI8F1]
Sign In for Pricing
View Details 
BNC940945-500 1x 500 µL
Double Stranded DNA (dsDNA) (121-3), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC741867-100 1x 100 µL
CD8A (Cytotoxic-&Suppressor T-Cell Marker) (rC8/468), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details