PEG10 Peptide - C-terminal region
PEG10 Peptide - C-terminal region
Product Specifications
Product Name Alternative
EDR, HB-1, MEF3L, Mar2, Mart2, RGAG3
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PEG10 Rabbit Polyclonal Antibody (orb581339) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001165909
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RKPRSPPRALVLPHIASHHQVDPTEPVGGARMRLTQEEKERRRKLNLCLY
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC403592-500 1x 500 µL
CD23 (Fc Epsilon RII) (FCER2/3592), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![GFAP Mouse Monoclonal Antibody [Clone ID: GA5]](https://cdn.genprice.uk/products/937/68dd189e061270361e8fd3a8/imageurl/am32829pu-t.webp)
BNC043121-100 1x 100 µL
Aurora B (Proliferation Marker) (AURKB/3121R), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 