PPP1R18 Peptide - C-terminal region
PPP1R18 Peptide - C-terminal region
Product Specifications
Product Name Alternative
HKMT1098, KIAA1949
UniProt
Q6NYC8
Field of Research
Musculoskeletal & Connective Tissue Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PPP1R18 Rabbit Polyclonal Antibody (orb325753) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_597728
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PEDAGTGGLRQQEEEAVELQPPPPAPLSPPPPAPTAPQPPGDPLMSRLFY
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![PISD Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5D8]](https://cdn.genprice.uk/products/937/68dd1b7e061270361ea1d72d/imageurl/ta807330bm.webp)
TA807330BM 100 µL
PISD Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5D8]
Sign In for Pricing
View Details ![HPRT (HPRT1) Mouse Monoclonal Antibody [Clone ID: AT2G8]](https://cdn.genprice.uk/products/937/68dd189b061270361e8fc547/imageurl/am09392pu-s.webp)
AM09392PU-S 50 µL
HPRT (HPRT1) Mouse Monoclonal Antibody [Clone ID: AT2G8]
Sign In for Pricing
View Details 
HAF-422-1 1 mL
Horseradish Peroxidase Conjugated Goat Affinity Purified Antibody to Cat IgG, Fc Specific Antibody
Sign In for Pricing
View Details 
AP11020PU-N 400 µL
Pk (V5) Epitope Tag (GKPIPNPLLGLDST) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 
