Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DEUP1 Peptide - N-terminal region

DEUP1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CCDC67

UniProt

Q05D60

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DEUP1 Rabbit Polyclonal Antibody (orb582060) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_857596.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HQMKQNKVPRKELPHLKEEIPFELSNLNQKLEEFRAKSREWDKQEILYQT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cd4 Rat Monoclonal Antibody [Clone ID: GK1.5]
AM26029LE-N 100 µg

Cd4 Rat Monoclonal Antibody [Clone ID: GK1.5]

Sign In for Pricing
View Details
Wnt7a Mouse Gene Knockout Kit (CRISPR)
KN519458 1 Kit

Wnt7a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Myometrium
CS500062 5x 5 µm

Frozen Tissue Sections, Myometrium

Sign In for Pricing
View Details
Benzylideneacetone
TRC-B279975-1G 1 g

Benzylideneacetone

Sign In for Pricing
View Details
N-Acetyl-S-(2,2-dichloroethenyl)-L-cysteine
TRC-A173580-1MG 1 mg

N-Acetyl-S-(2,2-dichloroethenyl)-L-cysteine

Sign In for Pricing
View Details
Tissue FFPE Sections, Endometrium
CS706822 5x 5 µm

Tissue FFPE Sections, Endometrium

Sign In for Pricing
View Details