Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DEUP1 Peptide - N-terminal region

DEUP1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CCDC67

UniProt

Q05D60

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DEUP1 Rabbit Polyclonal Antibody (orb582060) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_857596.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HQMKQNKVPRKELPHLKEEIPFELSNLNQKLEEFRAKSREWDKQEILYQT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human DIABLO activation kit by CRISPRa
GA111199 1 Kit

Human DIABLO activation kit by CRISPRa

Sign In for Pricing
View Details
Colloidal Gold Conjugated Rabbit Affinity Purified Antibody to Bovine IgG,  10nm
GAF-511-10 1 mL

Colloidal Gold Conjugated Rabbit Affinity Purified Antibody to Bovine IgG, 10nm

Sign In for Pricing
View Details
Elab Fluor®700 Anti-Mouse CD3ε Antibody[145-2C11]
E-AB-F1103UM1-01 25 µg

Elab Fluor®700 Anti-Mouse CD3ε Antibody[145-2C11]

Sign In for Pricing
View Details
Elab Fluor®700 Anti-Mouse CD3ε Antibody[145-2C11]
E-AB-F1103UM1-02 100 µg

Elab Fluor®700 Anti-Mouse CD3ε Antibody[145-2C11]

Sign In for Pricing
View Details
Recombinant Human GSTAL Protein (Trx Tag)
PDEH100656-01 20 µg

Recombinant Human GSTAL Protein (Trx Tag)

Sign In for Pricing
View Details
Recombinant Human GSTAL Protein (Trx Tag)
PDEH100656-02 100 µg

Recombinant Human GSTAL Protein (Trx Tag)

Sign In for Pricing
View Details