Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DDIAS Peptide - C-terminal region

DDIAS Peptide - C-terminal region

Product Specifications

Product Name Alternative

Noxin, C11orf82

UniProt

B4DMA1

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DDIAS Rabbit Polyclonal Antibody (orb55719) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_011543139.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AFKKPVFYSDLDGNYEKIRIFPENDKQQASPSCPKNIKTPSQKIRSPIVS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Pancreas
CS801567 5x 5 µm

Tissue FFPE Sections, Pancreas

Sign In for Pricing
View Details
Ndufs8 (NM_144870) Mouse Tagged ORF Clone
MG202305 10 µg

Ndufs8 (NM_144870) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
PCR Cabinet BPCR-102
BPCR-102 1 Unit

PCR Cabinet BPCR-102

Sign In for Pricing
View Details
Cytokeratin 7 (Glandular and Transitional Epithelial Marker) (rOV-TL12/30), CF488A conjugate, 0.1mg/mL
BNC881841-100 1x 100 µL

Cytokeratin 7 (Glandular and Transitional Epithelial Marker) (rOV-TL12/30), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
N-Tosyl-2-iodoaniline-d4
TRC-T664062-10MG 10 mg

N-Tosyl-2-iodoaniline-d4

Sign In for Pricing
View Details
Recombinant PAFAH1B1 Antibody
RC-4723-01 50 μL

Recombinant PAFAH1B1 Antibody

Sign In for Pricing
View Details