DDIAS Peptide - C-terminal region
DDIAS Peptide - C-terminal region
Product Specifications
Product Name Alternative
Noxin, C11orf82
UniProt
B4DMA1
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with DDIAS Rabbit Polyclonal Antibody (orb55719) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
XP_011543139.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: AFKKPVFYSDLDGNYEKIRIFPENDKQQASPSCPKNIKTPSQKIRSPIVS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Goat IgG Light chain Mouse Monoclonal Antibody [B8-C4-G4]](https://cdn.genprice.uk/products/992/68dd1c90061270361ea82936/imageurl/m0910-2.webp)
M0910-2 100 µL
Goat IgG Light chain Mouse Monoclonal Antibody [B8-C4-G4]
Sign In for Pricing
View Details 
MGB07F2-CON A/W 10x 96 Well Plates
Concanavalin A Coated - 96 well plates - 8 Well Breakable Strips on single well holding frame - Black PS
Sign In for Pricing
View Details 
BNUB1468-100 1x 100 µL
MCM7 (Proliferation Marker) (MCM7/1468), 0.2mg/mL
Sign In for Pricing
View Details 