Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDGFA Peptide - C-terminal region

PDGFA Peptide - C-terminal region

Product Specifications

Product Name Alternative

PDGF-A, PDGF1

UniProt

P04085

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PDGFA Rabbit Polyclonal Antibody (orb585780) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_148983

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTDVR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PIK3IP1 activation kit by CRISPRa
GA114418 1 Kit

Human PIK3IP1 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant CD38 Antibody
RC-15273-01 50 μL

Recombinant CD38 Antibody

Sign In for Pricing
View Details
Recombinant CD38 Antibody
RC-15273-02 100 µL

Recombinant CD38 Antibody

Sign In for Pricing
View Details
Recombinant CD38 Antibody
RC-15273-03 1 mL

Recombinant CD38 Antibody

Sign In for Pricing
View Details
RASAL1 Rabbit Polyclonal Antibody
TA380725 100 µL

RASAL1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cytokeratin 8 (K8/383), CF647 conjugate, 0.1mg/mL
BNC470383-100 1x 100 µL

Cytokeratin 8 (K8/383), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details