PDGFA Peptide - C-terminal region
PDGFA Peptide - C-terminal region
Product Specifications
Product Name Alternative
PDGF-A, PDGF1
UniProt
P04085
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PDGFA Rabbit Polyclonal Antibody (orb585780) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_148983
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: HRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTDVR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Semaphorin 4D (SEMA4D) Mouse Monoclonal Antibody [Clone ID: OTI8G5]](https://cdn.genprice.uk/products/937/68dd18ba061270361e9086f8/imageurl/cf809851.webp)
CF809851 100 µg
Semaphorin 4D (SEMA4D) Mouse Monoclonal Antibody [Clone ID: OTI8G5]
Sign In for Pricing
View Details ![BBOX1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2C8]](https://cdn.genprice.uk/products/937/68dd1b70061270361ea18500/imageurl/ta505787bm.webp)
TA505787BM 100 µL
BBOX1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2C8]
Sign In for Pricing
View Details ![PKC epsilon (PRKCE) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1B4]](https://cdn.genprice.uk/products/937/6868c334994c49e6dc3f1953/imageurl/ta502417bm.webp)
TA502417BM 100 µL
PKC epsilon (PRKCE) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1B4]
Sign In for Pricing
View Details 