Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MCPH1 Peptide - C-terminal region

MCPH1 Peptide - C-terminal region

Product Specifications

UniProt

E9PH63

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MCPH1 Rabbit Polyclonal Antibody (orb585793) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EAVGLKSTQNKGTTSKISNSSEGEAQSEHEPCFIVDCNMETSTEEKENLP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit PGR ELISA Kit
ERTP0097 96 Tests

Rabbit PGR ELISA Kit

Sign In for Pricing
View Details
Sntb1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3370507 1.0 µg DNA

Sntb1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Cycloguanil-d6 Nitrate
445278-01 2.5 mg

Cycloguanil-d6 Nitrate

Sign In for Pricing
View Details
Cycloguanil-d6 Nitrate
445278-02 25 mg

Cycloguanil-d6 Nitrate

Sign In for Pricing
View Details
ELISA kit for Mouse Disks large-associated protein 5 (DLGAP5)
KTE71251-01 48 Tests

ELISA kit for Mouse Disks large-associated protein 5 (DLGAP5)

Sign In for Pricing
View Details
ELISA kit for Mouse Disks large-associated protein 5 (DLGAP5)
KTE71251-02 96 Tests

ELISA kit for Mouse Disks large-associated protein 5 (DLGAP5)

Sign In for Pricing
View Details