Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MCPH1 Peptide - C-terminal region

MCPH1 Peptide - C-terminal region

Product Specifications

UniProt

E9PH63

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MCPH1 Rabbit Polyclonal Antibody (orb585793) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EAVGLKSTQNKGTTSKISNSSEGEAQSEHEPCFIVDCNMETSTEEKENLP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

β-Tubulin Antibody (5G3) , FITC Conjugated
N1263-01 50 µL

β-Tubulin Antibody (5G3) , FITC Conjugated

Sign In for Pricing
View Details
β-Tubulin Antibody (5G3) , FITC Conjugated
N1263-02 100 µL

β-Tubulin Antibody (5G3) , FITC Conjugated

Sign In for Pricing
View Details
β-Tubulin Antibody (5G3) , FITC Conjugated
N1263-03 500 µL

β-Tubulin Antibody (5G3) , FITC Conjugated

Sign In for Pricing
View Details
Syntenin 1 Rabbit Polyclonal Antibody (BF750)
orb2544912 100 µL

Syntenin 1 Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
Human ADRb3 (Adrenergic Receptor Beta 3) ELISA Kit
EK244763 96 Well

Human ADRb3 (Adrenergic Receptor Beta 3) ELISA Kit

Sign In for Pricing
View Details
Zfp641 AAV Vector (Mouse) (CMV)
51064104 1 µg

Zfp641 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details