Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIR3DL2 Peptide - C-terminal region

KIR3DL2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CD158K, NKAT-4, NKAT4, NKAT4B, p140

UniProt

P43630

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KIR3DL2 Rabbit Polyclonal Antibody (orb55720) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006728

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LFILLLFFLLYRWCSNKKNAAVMDQEPAGDRTVNRQDSDEQDPQEVTYAQ

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TRPV2 Pre-designed siRNA Set B
SI017434B 1 Each

Human TRPV2 Pre-designed siRNA Set B

Sign In for Pricing
View Details
CTSE Blocking Peptide
33R-3335 0.1 mg

CTSE Blocking Peptide

Sign In for Pricing
View Details
Guinea Pig Proteoglycan 4 ELISA kit
GTR10398494 96 Well

Guinea Pig Proteoglycan 4 ELISA kit

Sign In for Pricing
View Details
ASC/TMS1 Rabbit Polyclonal Antibody (HRP)
orb110452 100 µL

ASC/TMS1 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
AR (AN1-15) Alexa Fluor® 594
sc-56824 AF594 200 µg/mL

AR (AN1-15) Alexa Fluor® 594

Sign In for Pricing
View Details
SES-MaBr-4
ABC-TC005S 1 Vial

SES-MaBr-4

Sign In for Pricing
View Details