KIR3DL2 Peptide - C-terminal region
KIR3DL2 Peptide - C-terminal region
Product Specifications
Product Name Alternative
CD158K, NKAT-4, NKAT4, NKAT4B, p140
UniProt
P43630
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with KIR3DL2 Rabbit Polyclonal Antibody (orb55720) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_006728
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LFILLLFFLLYRWCSNKKNAAVMDQEPAGDRTVNRQDSDEQDPQEVTYAQ
More Discoveries
Explore Other Products
Browse additional items from our catalog
K1055006 1.0 µg DNA
IGKV2-10 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
Sign In for Pricing
View Details 
JOT-EK0467Mo 96 wells
Mouse Platelet-Derived Growth Factor-BB,PDGF-BB ELISA KIT
Sign In for Pricing
View Details