Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR2AG1 Peptide - C-terminal region

OR2AG1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR11-79, OR2AG3

UniProt

Q9H205

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR2AG1 Rabbit Polyclonal Antibody (orb326622) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001004489

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LAAILASYTQILLTVLHMPSNEGRKKALVTCSSHLTVVGMFYGAATFMYV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DLX3 Recombinant Rabbit Monoclonal Antibody [JE64-45]
HA722281 100 µL

DLX3 Recombinant Rabbit Monoclonal Antibody [JE64-45]

Sign In for Pricing
View Details
Septin 8 (SEPT8) (NM_001098811) Human Recombinant Protein
TP322095M 100 µg

Septin 8 (SEPT8) (NM_001098811) Human Recombinant Protein

Sign In for Pricing
View Details
Rhod (NM_007485) Mouse Tagged ORF Clone
MG202278 10 µg

Rhod (NM_007485) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
OR5D16 Antibody
8G910-AAT 50 µg

OR5D16 Antibody

Sign In for Pricing
View Details
RFP-Tag Mouse Monoclonal Antibody [Clone ID: 3G5]
AM26655AF-N 100 µg

RFP-Tag Mouse Monoclonal Antibody [Clone ID: 3G5]

Sign In for Pricing
View Details
LCZ696
TRC-L270005-5MG 5 mg

LCZ696

Sign In for Pricing
View Details