Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIF24 Peptide - C-terminal region

KIF24 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C9orf48, bA571F15.4

UniProt

Q5T7B8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_919289

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SLAEKPYCSQVDFIYRQERGGGSSFDLRKDASQSEVSGENEGNLPSPEED

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Apolipoprotein A-I/ApoAI Protein (His Tag, E. coli)
PKSH032081-01 10 µg

Recombinant Human Apolipoprotein A-I/ApoAI Protein (His Tag, E. coli)

Sign In for Pricing
View Details
Recombinant Human Apolipoprotein A-I/ApoAI Protein (His Tag, E. coli)
PKSH032081-02 50 µg

Recombinant Human Apolipoprotein A-I/ApoAI Protein (His Tag, E. coli)

Sign In for Pricing
View Details
Tissue Total RNA, Smooth muscle
CR559239 5 µg

Tissue Total RNA, Smooth muscle

Sign In for Pricing
View Details
Fumonisin B2
TRC-F862755-5MG 5 mg

Fumonisin B2

Sign In for Pricing
View Details
p21 (CDKN1A) Mouse Monoclonal Antibody [Clone ID: OTI2D3]
CF808505 100 µg

p21 (CDKN1A) Mouse Monoclonal Antibody [Clone ID: OTI2D3]

Sign In for Pricing
View Details
Vmn1r196 Mouse Gene Knockout Kit (CRISPR)
KN518987 1 Kit

Vmn1r196 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details