IST1 Peptide - C-terminal region
IST1 Peptide - C-terminal region
Product Specifications
UniProt
P53990
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with IST1 Rabbit Polyclonal Antibody (orb586835) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: TDLIDVGFTDDVKKGGPGRGGSGGFTAPVGGPDGTVPMPMPMPMPSANTP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GP-3201-15 1 mL
Colloidal Gold Conjugated Cytisus sscoparius Lectin (Scotch broom) -CSA-, 15nm
Sign In for Pricing
View Details 
![TNF alpha Recombinant Rabbit Monoclonal Antibody [PS01-07]](https://cdn.genprice.uk/products/992/68dd1c8c061270361ea81ce7/imageurl/ha722022.webp)
HA722022 100 µL
TNF alpha Recombinant Rabbit Monoclonal Antibody [PS01-07]
Sign In for Pricing
View Details 
