Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IST1 Peptide - C-terminal region

IST1 Peptide - C-terminal region

Product Specifications

UniProt

P53990

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IST1 Rabbit Polyclonal Antibody (orb586835) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TDLIDVGFTDDVKKGGPGRGGSGGFTAPVGGPDGTVPMPMPMPMPSANTP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRMDA Human Gene Knockout Kit (CRISPR)
KN417685 1 Kit

LRMDA Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Basic Water Purification System BBPS-302
BBPS-302 1 Unit

Basic Water Purification System BBPS-302

Sign In for Pricing
View Details
(DHQ)2PHAL
TRC-D299920-500MG 500 mg

(DHQ)2PHAL

Sign In for Pricing
View Details
Trap1a Mouse Gene Knockout Kit (CRISPR)
KN518140 1 Kit

Trap1a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Rhod (NM_007485) Mouse Tagged ORF Clone
MG202278 10 µg

Rhod (NM_007485) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Strept. Avidin FITC Colloidal Gold,  15nm
FGA-02-15 1 mL

Strept. Avidin FITC Colloidal Gold, 15nm

Sign In for Pricing
View Details