Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MICAL2 Peptide - N-terminal region

MICAL2 Peptide - N-terminal region

Product Specifications

UniProt

O94851

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HRNFYSKLKSKVTTWKAKALWYKLDKRGSHKEYKRGKSCTNTKCLIVGGG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SPINT4 activation kit by CRISPRa
GA118210 1 Kit

Human SPINT4 activation kit by CRISPRa

Sign In for Pricing
View Details
Human GGA1, C-His Tag
HA210748-01 20 µg

Human GGA1, C-His Tag

Sign In for Pricing
View Details
Human GGA1, C-His Tag
HA210748-02 50 µg

Human GGA1, C-His Tag

Sign In for Pricing
View Details
Human GGA1, C-His Tag
HA210748-03 100 µg

Human GGA1, C-His Tag

Sign In for Pricing
View Details
MDM2 (MDM2/2414), CF488A conjugate, 0.1mg/mL
BNC882414-100 1x 100 µL

MDM2 (MDM2/2414), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Colloidal Gold Conjugated Chicken Affinity Purified Antibody to Protein G,  40nm
GM-501-40 1 mL

Colloidal Gold Conjugated Chicken Affinity Purified Antibody to Protein G, 40nm

Sign In for Pricing
View Details