Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MICAL2 Peptide - N-terminal region

MICAL2 Peptide - N-terminal region

Product Specifications

UniProt

O94851

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HRNFYSKLKSKVTTWKAKALWYKLDKRGSHKEYKRGKSCTNTKCLIVGGG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Bromocinnamic Acid
TRC-B682430-25G 25 g

2-Bromocinnamic Acid

Sign In for Pricing
View Details
1-Phenyl-1,2-propanediol (Mixture of Diastereomers)
TRC-P336095-25MG 25 mg

1-Phenyl-1,2-propanediol (Mixture of Diastereomers)

Sign In for Pricing
View Details
SDF1 Antibody
KC-1710-01 50 μL

SDF1 Antibody

Sign In for Pricing
View Details
SDF1 Antibody
KC-1710-02 100 µL

SDF1 Antibody

Sign In for Pricing
View Details
SDF1 Antibody
KC-1710-03 1 mL

SDF1 Antibody

Sign In for Pricing
View Details
ZNF688 Antibody
8C11407-AAT 50 µg

ZNF688 Antibody

Sign In for Pricing
View Details