Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INTS11 Peptide - C-terminal region

INTS11 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RC68, INT11, RC-68, CPSF3L, CPSF73L

UniProt

Q5TA45

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with INTS11 Rabbit Polyclonal Antibody (orb586968) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001243385.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TESTYATTIRDSKRCRERDFLKKVHETVERGGKGAHEPEGAHLLLHGADR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal CDR1 Antibody
NBP2-57758 100 µL

Rabbit Polyclonal CDR1 Antibody

Sign In for Pricing
View Details
RPS6P12 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K2016108 1.0 µg DNA

RPS6P12 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
MStrawberry-Tag Mouse mAb
EM1164-01 50 µL

MStrawberry-Tag Mouse mAb

Sign In for Pricing
View Details
MStrawberry-Tag Mouse mAb
EM1164-02 100 µL

MStrawberry-Tag Mouse mAb

Sign In for Pricing
View Details
TMEM24 (C2CD2L) Human Recombinant Protein
TP726079 50 µg

TMEM24 (C2CD2L) Human Recombinant Protein

Sign In for Pricing
View Details
IRL-1620 TFA
MBS5763715 Inquire

IRL-1620 TFA

Sign In for Pricing
View Details