Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INTS11 Peptide - C-terminal region

INTS11 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RC68, INT11, RC-68, CPSF3L, CPSF73L

UniProt

Q5TA45

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with INTS11 Rabbit Polyclonal Antibody (orb586968) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001243385.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TESTYATTIRDSKRCRERDFLKKVHETVERGGKGAHEPEGAHLLLHGADR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IBP4 Antibody
45612-01 50 µL

IBP4 Antibody

Sign In for Pricing
View Details
IBP4 Antibody
45612-02 100 µL

IBP4 Antibody

Sign In for Pricing
View Details
Super ECL Plus Western Blotting Substrate
EZWB01-SEP50 2x 50 mL

Super ECL Plus Western Blotting Substrate

Sign In for Pricing
View Details
GBP2 Protein Vector (Mouse) (pPM-C-HA)
21358024 500 ng

GBP2 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Allergen Gal d 4 (46-61), chicken
M29807-01 100 mg

Allergen Gal d 4 (46-61), chicken

Sign In for Pricing
View Details
Allergen Gal d 4 (46-61), chicken
M29807-02 200 mg

Allergen Gal d 4 (46-61), chicken

Sign In for Pricing
View Details