Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANKRD62 Peptide - C-terminal region

ANKRD62 Peptide - C-terminal region

Product Specifications

UniProt

A6NC57

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ANKRD62 Rabbit Polyclonal Antibody (orb326797) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_003960794

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NKGLMKECTLLKERQCQYEKEKEEREVVRRQLQREVDDALNKQLLLEAML

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Wfdc12 sgRNA CRISPR Lentivector set (Mouse)
K4071501 3x 1.0 µg

Wfdc12 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
PKN2 (7V11) Rabbit Monoclonal Antibody
E28M6767 100 µL

PKN2 (7V11) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Vmn2r61 (NM_001105058) Mouse Tagged ORF Clone
MR212998 10 µg

Vmn2r61 (NM_001105058) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Cfz-2 Antibody
orb800184 2 mg

Cfz-2 Antibody

Sign In for Pricing
View Details
Recombinant Mycoplasma 46 kDa surface antigen Protein, His, Yeast-1mg
QP7000-ye-1mg 1mg

Recombinant Mycoplasma 46 kDa surface antigen Protein, His, Yeast-1mg

Sign In for Pricing
View Details
Retinoschisin (RS1) Antibody (Biotin)
abx305205-01 20 µg

Retinoschisin (RS1) Antibody (Biotin)

Sign In for Pricing
View Details