Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANKRD62 Peptide - C-terminal region

ANKRD62 Peptide - C-terminal region

Product Specifications

UniProt

A6NC57

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ANKRD62 Rabbit Polyclonal Antibody (orb326797) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_003960794

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NKGLMKECTLLKERQCQYEKEKEEREVVRRQLQREVDDALNKQLLLEAML

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KALRN Peptide - middle region
orb2000935 100 µg

KALRN Peptide - middle region

Sign In for Pricing
View Details
MFGE8 Human Over-expression Lysate
orb1377790 20 µg

MFGE8 Human Over-expression Lysate

Sign In for Pricing
View Details
RNY5P7 3'UTR Luciferase Stable Cell Line
TU020346 1.0 mL

RNY5P7 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Recombinant Mouse Superoxide dismutase [Cu-Zn] (Sod1)
AP72794 1 mg

Recombinant Mouse Superoxide dismutase [Cu-Zn] (Sod1)

Sign In for Pricing
View Details
Mouse Neurofilament, Light Polypeptide (NEFL) ELISA Kit
RDR-NEFL-Mu-48Tests 48 Tests

Mouse Neurofilament, Light Polypeptide (NEFL) ELISA Kit

Sign In for Pricing
View Details
Rat Nuclear Receptor Subfamily 3, Group C, Member 1 (NR3C1) ELISA Kit
RDR-NR3C1-Ra-48Tests 48 Tests

Rat Nuclear Receptor Subfamily 3, Group C, Member 1 (NR3C1) ELISA Kit

Sign In for Pricing
View Details