CEP89 Peptide - N-terminal region
CEP89 Peptide - N-terminal region
Product Specifications
UniProt
Q96ST8
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CEP89 Rabbit Polyclonal Antibody (orb587164) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: DRGGHSDDLYAVPHRNQVPLLHEVNSEDDENISHQDGFPGSPPAPQRTQQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TP329827 20 µg
LY108 (SLAMF6) (NM_001184715) Human Recombinant Protein
Sign In for Pricing
View Details 
TP303941 20 µg
Clusterin (CLU) (NM_203339) Human Recombinant Protein
Sign In for Pricing
View Details 
![Sox2 Mouse Monoclonal Antibody [Clone ID: 10F10]](https://cdn.genprice.uk/products/937/68dd189a061270361e8fc1f3/imageurl/am06557su-n.webp)
AM06557SU-N 100 µL
Sox2 Mouse Monoclonal Antibody [Clone ID: 10F10]
Sign In for Pricing
View Details