Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEP89 Peptide - N-terminal region

CEP89 Peptide - N-terminal region

Product Specifications

UniProt

Q96ST8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CEP89 Rabbit Polyclonal Antibody (orb587164) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DRGGHSDDLYAVPHRNQVPLLHEVNSEDDENISHQDGFPGSPPAPQRTQQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRPL13 (NM_014078) Human Recombinant Protein
TP306334M 100 µg

MRPL13 (NM_014078) Human Recombinant Protein

Sign In for Pricing
View Details
MTAP Recombinant Mouse monoclonal Antibody
HA601445 100 µL

MTAP Recombinant Mouse monoclonal Antibody

Sign In for Pricing
View Details
Chrna9 Mouse Gene Knockout Kit (CRISPR)
KN503311 1 Kit

Chrna9 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Mouse/Human CD11b Antibody[M1/70]
E-AB-F1081J-01 50 Tests

PerCP/Cyanine5.5 Anti-Mouse/Human CD11b Antibody[M1/70]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Mouse/Human CD11b Antibody[M1/70]
E-AB-F1081J-02 100 Tests

PerCP/Cyanine5.5 Anti-Mouse/Human CD11b Antibody[M1/70]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Mouse/Human CD11b Antibody[M1/70]
E-AB-F1081J-03 2x 100 Tests

PerCP/Cyanine5.5 Anti-Mouse/Human CD11b Antibody[M1/70]

Sign In for Pricing
View Details