NSMCE4A Peptide - C-terminal region
NSMCE4A Peptide - C-terminal region
Product Specifications
Product Name Alternative
C10orf86, NS4EA, NSE4A
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with NSMCE4A Rabbit Polyclonal Antibody (orb587571) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001161337
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: NEENEGFEHNTQVRNQGIIALSYRDWEIVKTFEISEPVITPSQRQQKPSA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC682289-100 1x 100 µL
Human Kappa Light Chain / IGKC (B-Cell Marker) (KLC2289R), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
