Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NSMCE4A Peptide - C-terminal region

NSMCE4A Peptide - C-terminal region

Product Specifications

Product Name Alternative

C10orf86, NS4EA, NSE4A

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NSMCE4A Rabbit Polyclonal Antibody (orb587571) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001161337

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NEENEGFEHNTQVRNQGIIALSYRDWEIVKTFEISEPVITPSQRQQKPSA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ɑ-Butyric Acid NHS Ester-ω-Fmoc Amino PEG
135000-22-35.500MG 500 mg

Ɑ-Butyric Acid NHS Ester-ω-Fmoc Amino PEG

Sign In for Pricing
View Details
PAX6 (PAX6/498), CF405S conjugate, 0.1mg/mL
BNC040498-100 1x 100 µL

PAX6 (PAX6/498), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Zinc Chloride
TRC-Z438900-100G 100 g

Zinc Chloride

Sign In for Pricing
View Details
Recombinant Human IgG2-Fc Protein (257 Ser/Ala)
PKSH030615-01 100 µg

Recombinant Human IgG2-Fc Protein (257 Ser/Ala)

Sign In for Pricing
View Details
Recombinant Human IgG2-Fc Protein (257 Ser/Ala)
PKSH030615-02 1 mg

Recombinant Human IgG2-Fc Protein (257 Ser/Ala)

Sign In for Pricing
View Details
Mouse Wwc2 activation kit by CRISPRa
GA205464 1 Kit

Mouse Wwc2 activation kit by CRISPRa

Sign In for Pricing
View Details