Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GREB1 Peptide - N-terminal region

GREB1 Peptide - N-terminal region

Product Specifications

UniProt

Q4ZG55

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GREB1 Rabbit Polyclonal Antibody (orb575232) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_683701

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MGNSYAGQLKTTRFEEVLHNSIEASLRSNNLVPRPIFSQLYLEAEQQLAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MTMR9 (Biotin)
569386-01 50 µL

MTMR9 (Biotin)

Sign In for Pricing
View Details
MTMR9 (Biotin)
569386-02 100 µL

MTMR9 (Biotin)

Sign In for Pricing
View Details
PI-1840
C12708-10mg 10 mg

PI-1840

Sign In for Pricing
View Details
Neuregulin 3 Immunizing Peptide
orb17381 100 µg

Neuregulin 3 Immunizing Peptide

Sign In for Pricing
View Details
Rabbit Polyclonal TGN46 Antibody [DyLight 650]
NBP1-49643C 0.1 mL

Rabbit Polyclonal TGN46 Antibody [DyLight 650]

Sign In for Pricing
View Details
VAV2 Rabbit pAb
A19883-01 20 µL

VAV2 Rabbit pAb

Sign In for Pricing
View Details