Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GREB1 Peptide - N-terminal region

GREB1 Peptide - N-terminal region

Product Specifications

UniProt

Q4ZG55

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GREB1 Rabbit Polyclonal Antibody (orb575232) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_683701

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MGNSYAGQLKTTRFEEVLHNSIEASLRSNNLVPRPIFSQLYLEAEQQLAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DPM2 Human Pre-designed siRNA Set A
HY-RS03959 1 Set

DPM2 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
Recombinant Prochlorococcus marinus 1,4-alpha-glucan branching enzyme GlgB (glgB), partial
MBS1368025 Inquire

Recombinant Prochlorococcus marinus 1,4-alpha-glucan branching enzyme GlgB (glgB), partial

Sign In for Pricing
View Details
Rln1 siRNA Oligos set (Mouse)
39628174 3x 5 nmol

Rln1 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
Anti-Human HLA-A, B, C Antibody (W6/32), APC
HM834137-01 1 Each

Anti-Human HLA-A, B, C Antibody (W6/32), APC

Sign In for Pricing
View Details
Anti-Human HLA-A, B, C Antibody (W6/32), APC
HM834137-02 100 Tests

Anti-Human HLA-A, B, C Antibody (W6/32), APC

Sign In for Pricing
View Details
STXBP3 3'UTR GFP Stable Cell Line
TU074882 1.0 mL

STXBP3 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details