Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PCLO Peptide - C-terminal region

PCLO Peptide - C-terminal region

Product Specifications

UniProt

Q9Y6V0

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PCLO Rabbit Polyclonal Antibody (orb326488) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SHGIFPDPSKDMQVPTIEKSHSSPGSSKSSSEGHLRSHGPSRSQSKTSVT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABC B5 (ATP Binding Cassette Sub-family B (MDR/TAP) Member 5, ATP-binding Cassette Sub-family B Member 5, ABCB 5, ABCB5, ABCB5alpha, ABCB5beta, EST422562, P-glycoprotein ABCB5) (PE) discontinued
A0004-02Y-PE 100 µL

ABC B5 (ATP Binding Cassette Sub-family B (MDR/TAP) Member 5, ATP-binding Cassette Sub-family B Member 5, ABCB 5, ABCB5, ABCB5alpha, ABCB5beta, EST422562, P-glycoprotein ABCB5) (PE) discontinued

Sign In for Pricing
View Details
C12orf72 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0293707 1.0 µg DNA

C12orf72 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
EYA4 Human shRNA Lentiviral Particle (Locus ID 2070)
TL304714V 500 µL Each

EYA4 Human shRNA Lentiviral Particle (Locus ID 2070)

Sign In for Pricing
View Details
HSD17B7
319588-01 50 µL

HSD17B7

Sign In for Pricing
View Details
HSD17B7
319588-02 100 µL

HSD17B7

Sign In for Pricing
View Details
Rabbit Polyclonal CNPase Antibody
NBP1-85995-25ul 25 µL

Rabbit Polyclonal CNPase Antibody

Sign In for Pricing
View Details