Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PCLO Peptide - C-terminal region

PCLO Peptide - C-terminal region

Product Specifications

UniProt

Q9Y6V0

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PCLO Rabbit Polyclonal Antibody (orb326488) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SHGIFPDPSKDMQVPTIEKSHSSPGSSKSSSEGHLRSHGPSRSQSKTSVT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TCP1 beta Rabbit Polyclonal Antibody (Cy3)
orb980341 100 µL

TCP1 beta Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
Recombinant Anti-Apolipoprotein D Rabbit mAb
CMA6109-01 30 µL

Recombinant Anti-Apolipoprotein D Rabbit mAb

Sign In for Pricing
View Details
Recombinant Anti-Apolipoprotein D Rabbit mAb
CMA6109-02 50 μL

Recombinant Anti-Apolipoprotein D Rabbit mAb

Sign In for Pricing
View Details
Recombinant Anti-Apolipoprotein D Rabbit mAb
CMA6109-03 100 µL

Recombinant Anti-Apolipoprotein D Rabbit mAb

Sign In for Pricing
View Details
Recombinant Anti-Apolipoprotein D Rabbit mAb
CMA6109-04 200 µL

Recombinant Anti-Apolipoprotein D Rabbit mAb

Sign In for Pricing
View Details
ARPC1A (NM_006409) Human Untagged Clone
SC324215 10 µg

ARPC1A (NM_006409) Human Untagged Clone

Sign In for Pricing
View Details