Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTNNA2 Peptide - C-terminal region

CTNNA2 Peptide - C-terminal region

Product Specifications

UniProt

P26232

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CTNNA2 Rabbit Polyclonal Antibody (orb326506) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: YQKVYGTAAVNSPVVSWKMKAPEKKPLVKREKPEEFQTRVRRGSQKKHIS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ap5z1 Mouse Gene Knockout Kit (CRISPR)
KN501378 1 Kit

Ap5z1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Vps26c activation kit by CRISPRa
GA201034 1 Kit

Mouse Vps26c activation kit by CRISPRa

Sign In for Pricing
View Details
N-Phenylpropyl Alverine
TRC-P575780-250MG 250 mg

N-Phenylpropyl Alverine

Sign In for Pricing
View Details
2-Acetamido-N-(e-aminocaproyl)-2-deoxy-Beta-D-glucopyranosylamine
TRC-A139000-10MG 10 mg

2-Acetamido-N-(e-aminocaproyl)-2-deoxy-Beta-D-glucopyranosylamine

Sign In for Pricing
View Details
APC Anti-Human/Mouse CD44 Antibody[IM7]
E-AB-F1100UE-01 25 µg

APC Anti-Human/Mouse CD44 Antibody[IM7]

Sign In for Pricing
View Details
APC Anti-Human/Mouse CD44 Antibody[IM7]
E-AB-F1100UE-02 100 µg

APC Anti-Human/Mouse CD44 Antibody[IM7]

Sign In for Pricing
View Details