CTNNA2 Peptide - C-terminal region
CTNNA2 Peptide - C-terminal region
Product Specifications
UniProt
P26232
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CTNNA2 Rabbit Polyclonal Antibody (orb326506) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: YQKVYGTAAVNSPVVSWKMKAPEKKPLVKREKPEEFQTRVRRGSQKKHIS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![FITC Anti-Mouse Ly6C Antibody[Monts 1]](https://cdn.genprice.uk/products/763/68dd1497061270361e7ce108/imageurl/e-ab-f1121uc.webp)
