Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDRG4 Peptide - C-terminal region

NDRG4 Peptide - C-terminal region

Product Specifications

UniProt

B7Z9X4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NDRG4 Rabbit Polyclonal Antibody (orb586058) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GYMPSASMTRLARSRTASLTSASSVDGSRPQACTHSESSEGLGQVNHTME

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Kelch repeat and BTB domain-containing protein 5, KBTBD5 ELISA Kit
MBS9332076-01 48 Well

Human Kelch repeat and BTB domain-containing protein 5, KBTBD5 ELISA Kit

Sign In for Pricing
View Details
Human Kelch repeat and BTB domain-containing protein 5, KBTBD5 ELISA Kit
MBS9332076-02 96 Well

Human Kelch repeat and BTB domain-containing protein 5, KBTBD5 ELISA Kit

Sign In for Pricing
View Details
Human Kelch repeat and BTB domain-containing protein 5, KBTBD5 ELISA Kit
MBS9332076-03 5x 96 Well

Human Kelch repeat and BTB domain-containing protein 5, KBTBD5 ELISA Kit

Sign In for Pricing
View Details
Human Kelch repeat and BTB domain-containing protein 5, KBTBD5 ELISA Kit
MBS9332076-04 10x 96 Well

Human Kelch repeat and BTB domain-containing protein 5, KBTBD5 ELISA Kit

Sign In for Pricing
View Details
Mouse Fibroblast Growth Factor Receptor 3 (FGFR3) ELISA Kit-Sandwich
EK5F758-01 48 Test

Mouse Fibroblast Growth Factor Receptor 3 (FGFR3) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Mouse Fibroblast Growth Factor Receptor 3 (FGFR3) ELISA Kit-Sandwich
EK5F758-02 96 Tests

Mouse Fibroblast Growth Factor Receptor 3 (FGFR3) ELISA Kit-Sandwich

Sign In for Pricing
View Details