Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDRG4 Peptide - C-terminal region

NDRG4 Peptide - C-terminal region

Product Specifications

UniProt

B7Z9X4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NDRG4 Rabbit Polyclonal Antibody (orb586058) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GYMPSASMTRLARSRTASLTSASSVDGSRPQACTHSESSEGLGQVNHTME

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal T-box 19 Antibody (OTI1C9) [Dylight 594]
NBP2-74469DL594 0.1 mL

Mouse Monoclonal T-box 19 Antibody (OTI1C9) [Dylight 594]

Sign In for Pricing
View Details
ADHFE1
304955-01 50 µL

ADHFE1

Sign In for Pricing
View Details
ADHFE1
304955-02 100 µL

ADHFE1

Sign In for Pricing
View Details
transgelin 2 Recombinant Protein Antigen
NBP1-89722PEP 0.1 mL

transgelin 2 Recombinant Protein Antigen

Sign In for Pricing
View Details
CCM2 Antibody
orb1256944 100 µL

CCM2 Antibody

Sign In for Pricing
View Details
NR2E3 Protein Lysate (Mouse) with C-HA Tag
32134034 100 µg

NR2E3 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details