Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDRG4 Peptide - C-terminal region

NDRG4 Peptide - C-terminal region

Product Specifications

UniProt

B7Z9X4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NDRG4 Rabbit Polyclonal Antibody (orb586058) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GYMPSASMTRLARSRTASLTSASSVDGSRPQACTHSESSEGLGQVNHTME

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

POLR2C Antibody
orb2808160 100 µL

POLR2C Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal Nestin Antibody [Alexa Fluor 488]
NB300-265AF488 0.1 mL

Rabbit Polyclonal Nestin Antibody [Alexa Fluor 488]

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O45:K1 (strain S88/ExPEC) YBIX Polyclonal Antibody
MBS7176321 Inquire

Rabbit anti-Escherichia coli O45:K1 (strain S88/ExPEC) YBIX Polyclonal Antibody

Sign In for Pricing
View Details
Human OLFM4 (Olfactomedin 4) ELISA Kit
EH3477 96 Tests

Human OLFM4 (Olfactomedin 4) ELISA Kit

Sign In for Pricing
View Details
RBM4, CT (RBM4, RBM4A, RNA-binding protein 4, Lark homolog, RNA-binding motif protein 4, RNA-binding motif protein 4a) (MaxLight 405)
MBS6340778-01 0.1 mL

RBM4, CT (RBM4, RBM4A, RNA-binding protein 4, Lark homolog, RNA-binding motif protein 4, RNA-binding motif protein 4a) (MaxLight 405)

Sign In for Pricing
View Details
RBM4, CT (RBM4, RBM4A, RNA-binding protein 4, Lark homolog, RNA-binding motif protein 4, RNA-binding motif protein 4a) (MaxLight 405)
MBS6340778-02 5x 0.1 mL

RBM4, CT (RBM4, RBM4A, RNA-binding protein 4, Lark homolog, RNA-binding motif protein 4, RNA-binding motif protein 4a) (MaxLight 405)

Sign In for Pricing
View Details