Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMP28 Peptide - N-terminal region

MMP28 Peptide - N-terminal region

Product Specifications

UniProt

C0H5X0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MMP28 Rabbit Polyclonal Antibody (orb586077) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LDAQPAERGGQELRKEAEAFLEKYGYLNEQVPKAPTSTRFSDAIRAFQWV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSMD2 Antibody
8C10956-AAT 50 µg

PSMD2 Antibody

Sign In for Pricing
View Details
RED1 (ADARB1) (NM_001160230) Human Over-expression Lysate
LY431557 100 µg

RED1 (ADARB1) (NM_001160230) Human Over-expression Lysate

Sign In for Pricing
View Details
Stanniocalcin-1 Antibody
KC-27086-01 50 μL

Stanniocalcin-1 Antibody

Sign In for Pricing
View Details
Stanniocalcin-1 Antibody
KC-27086-02 100 µL

Stanniocalcin-1 Antibody

Sign In for Pricing
View Details
Stanniocalcin-1 Antibody
KC-27086-03 1 mL

Stanniocalcin-1 Antibody

Sign In for Pricing
View Details
TRK fused gene (TFG) (NM_001007565) Human Over-expression Lysate
LC423514 20 µg

TRK fused gene (TFG) (NM_001007565) Human Over-expression Lysate

Sign In for Pricing
View Details