Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMP28 Peptide - N-terminal region

MMP28 Peptide - N-terminal region

Product Specifications

UniProt

C0H5X0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MMP28 Rabbit Polyclonal Antibody (orb586077) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LDAQPAERGGQELRKEAEAFLEKYGYLNEQVPKAPTSTRFSDAIRAFQWV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Thrombomodulin (TM) ELISA Kit
RDR-TM-p-01 96 Tests

Porcine Thrombomodulin (TM) ELISA Kit

Sign In for Pricing
View Details
Porcine Thrombomodulin (TM) ELISA Kit
RDR-TM-p-02 48 Tests

Porcine Thrombomodulin (TM) ELISA Kit

Sign In for Pricing
View Details
Equilin
TRC-E592800-250MG 250 mg

Equilin

Sign In for Pricing
View Details
Tricine
TRC-T773653-25G 25 g

Tricine

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Mouse CD106 Antibody[M/K-2.7]
E-AB-F1091UJ-01 25 µg

PerCP/Cyanine5.5 Anti-Mouse CD106 Antibody[M/K-2.7]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Mouse CD106 Antibody[M/K-2.7]
E-AB-F1091UJ-02 100 µg

PerCP/Cyanine5.5 Anti-Mouse CD106 Antibody[M/K-2.7]

Sign In for Pricing
View Details