CACNA2D4 Peptide - middle region
CACNA2D4 Peptide - middle region
Product Specifications
UniProt
E7EUE0
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CACNA2D4 Rabbit Polyclonal Antibody (orb586302) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ADLNHEFNESLVFDYYNSVLINERDEKGNFVELGAEFLLESNAHFSNLPV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
sc-400430-LAC-2 200 µL
DARPP-32 Lentiviral Activation Particles (h2)
Sign In for Pricing
View Details K1917505 3x 1.0 µg
RPL18AP1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
Sign In for Pricing
View Details 046769 50 µg
A2M/CPAMD5/Alpha-2-macroglobulin, Recombinant, Human, His-Tag, Active discontinued
Sign In for Pricing
View Details 
MBS7195270 Inquire
Rabbit anti-Oryza sativa subsp. japonica (Rice) EXPA25 Polyclonal Antibody
Sign In for Pricing
View Details