KIR2DL3 Peptide - middle region
KIR2DL3 Peptide - middle region
Product Specifications
UniProt
P43628
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with KIR2DL3 Rabbit Polyclonal Antibody (orb586384) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GTSVVIILFILLLFFLLHRWCCNKKNAVVMDQEPAGNRTVNREDSDEQDP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
PKSM041191-01 10 µg
Recombinant Mouse Legumain/LGMN Protein (His Tag)
Sign In for Pricing
View Details PKSM041191-02 50 µg
Recombinant Mouse Legumain/LGMN Protein (His Tag)
Sign In for Pricing
View Details 
TRC-D989020-2.5G 2.5 g
1-(((Diethylamino)oxy)carbonyl)cyclopropane-1-carbonyl Chloride
Sign In for Pricing
View Details