Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SAMD9L Peptide - N-terminal region

SAMD9L Peptide - N-terminal region

Product Specifications

UniProt

Q8IVG5

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LIKRSYNKLNSKSPESDNHDPGQLDNSKPSKTEHQKNPKHTKKEEENSMS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RBBP4 cDNA Clone
MBS1276988-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

RBBP4 cDNA Clone

Sign In for Pricing
View Details
RBBP4 cDNA Clone
MBS1276988-02 5x 0.01 mg Plasmid + 5x 0.2 mL Glycerol-Stock

RBBP4 cDNA Clone

Sign In for Pricing
View Details
AMH antibody
70R-6224 100 µL

AMH antibody

Sign In for Pricing
View Details
CEP170 Antibody
A12386-50UG 50 µg

CEP170 Antibody

Sign In for Pricing
View Details
Auglurant 25mg
A20958-25 25 mg

Auglurant 25mg

Sign In for Pricing
View Details
M/IMO207-SA-PHOLUMC-150x150/1-B Marine & IMO Signs & Labels (Adhesive)
195104 1 Pack (1 Panel (s) x 1 Pack)

M/IMO207-SA-PHOLUMC-150x150/1-B Marine & IMO Signs & Labels (Adhesive)

Sign In for Pricing
View Details