Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SAMD9L Peptide - N-terminal region

SAMD9L Peptide - N-terminal region

Product Specifications

UniProt

Q8IVG5

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LIKRSYNKLNSKSPESDNHDPGQLDNSKPSKTEHQKNPKHTKKEEENSMS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Growth hormone receptor/GHR Rabbit Polyclonal Antibody (PE)
orb2607220 100 µg

Growth hormone receptor/GHR Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
Rel B Recombinant Rabbit mAb
BS45988 50 ul

Rel B Recombinant Rabbit mAb

Sign In for Pricing
View Details
ZC3H13 Antibody
CSB-PA004565-01 50 µg

ZC3H13 Antibody

Sign In for Pricing
View Details
ZC3H13 Antibody
CSB-PA004565-02 100 µg

ZC3H13 Antibody

Sign In for Pricing
View Details
ARL8A Double Nickase Plasmid (m)
sc-427153-NIC 20 µg

ARL8A Double Nickase Plasmid (m)

Sign In for Pricing
View Details
Interleukin 6 (IL6) Magnetic Fluorescence Assay Kit
MBS2154666-01 96 Tests

Interleukin 6 (IL6) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details