NSUN5P1 Peptide - middle region
NSUN5P1 Peptide - middle region
Product Specifications
Product Name Alternative
NSUN5B, WBSCR20B
UniProt
Q3KNT7
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with NSUN5P1 Rabbit Polyclonal Antibody (orb586864) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LRASPKTTLSGGFFVAVIERVEMPTSASQAKASAPERTPSPAPKRKKRAK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
NBP3-14125 100 µg
Mouse Monoclonal FOXB2 Antibody (PCRP-FOXB2-2B2) - Azide and BSA Free
Sign In for Pricing
View Details orb347106 1 mg
Golden Syrian Hamster IgG (H&L) Antibody Fluorescein Conjugated Pre-Adsorbed
Sign In for Pricing
View Details 
MBS6287713-01 0.2 mL
COL4A6, ID (COL4A6, Collagen alpha-6(IV) chain) (AP)
Sign In for Pricing
View Details MBS6287713-02 5x 0.2 mL
COL4A6, ID (COL4A6, Collagen alpha-6(IV) chain) (AP)
Sign In for Pricing
View Details