Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NSUN5P1 Peptide - middle region

NSUN5P1 Peptide - middle region

Product Specifications

Product Name Alternative

NSUN5B, WBSCR20B

UniProt

Q3KNT7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NSUN5P1 Rabbit Polyclonal Antibody (orb586864) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LRASPKTTLSGGFFVAVIERVEMPTSASQAKASAPERTPSPAPKRKKRAK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti Rat plasmin Affinity purified
MBS480251-01 0.1 mg

Anti Rat plasmin Affinity purified

Sign In for Pricing
View Details
Anti Rat plasmin Affinity purified
MBS480251-02 5x 0.1 mg

Anti Rat plasmin Affinity purified

Sign In for Pricing
View Details
1700129C05Rik CRISPRa sgRNA lentivector (set of three targets)(Mouse)
10279124 3x 1.0µg DNA

1700129C05Rik CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
ERdj4 CRISPR/Cas9 KO Plasmid (m)
sc-424235 20 µg

ERdj4 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
Mouse CTLA4 Protein, Fc Tag
MOP1384 100 µg

Mouse CTLA4 Protein, Fc Tag

Sign In for Pricing
View Details
1,2-Dichloro-1,1,2-trifluoro-4-iodobutane
PC4836-01 25 g

1,2-Dichloro-1,1,2-trifluoro-4-iodobutane

Sign In for Pricing
View Details