Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NSUN5P1 Peptide - middle region

NSUN5P1 Peptide - middle region

Product Specifications

Product Name Alternative

NSUN5B, WBSCR20B

UniProt

Q3KNT7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NSUN5P1 Rabbit Polyclonal Antibody (orb586864) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LRASPKTTLSGGFFVAVIERVEMPTSASQAKASAPERTPSPAPKRKKRAK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KAP1/TRIM28 Rabbit Polyclonal Antibody (Biotin)
orb2618774 100 µg

KAP1/TRIM28 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Mouse Monoclonal Bcl G Antibody (OTI6D1) [FITC]
NBP2-72204F 0.1 mL

Mouse Monoclonal Bcl G Antibody (OTI6D1) [FITC]

Sign In for Pricing
View Details
CDC40 293 Cell Lysate
406878 0.1 mg

CDC40 293 Cell Lysate

Sign In for Pricing
View Details
RPS15AP38 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV783452 1.0 µg DNA

RPS15AP38 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Research Grade Lerodalcibep Antibody
orb3155507-01 100 µg

Research Grade Lerodalcibep Antibody

Sign In for Pricing
View Details
Research Grade Lerodalcibep Antibody
orb3155507-02 1 mg

Research Grade Lerodalcibep Antibody

Sign In for Pricing
View Details