Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NSUN5P1 Peptide - middle region

NSUN5P1 Peptide - middle region

Product Specifications

Product Name Alternative

NSUN5B, WBSCR20B

UniProt

Q3KNT7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NSUN5P1 Rabbit Polyclonal Antibody (orb586864) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LRASPKTTLSGGFFVAVIERVEMPTSASQAKASAPERTPSPAPKRKKRAK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NEK1 Antibody (C-term)
orb1928632-01 50 µL

NEK1 Antibody (C-term)

Sign In for Pricing
View Details
NEK1 Antibody (C-term)
orb1928632-02 100 µL

NEK1 Antibody (C-term)

Sign In for Pricing
View Details
QTRT1 Rabbit Polyclonal Antibody
orb1879736-01 30 µL

QTRT1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
QTRT1 Rabbit Polyclonal Antibody
orb1879736-02 50 µL

QTRT1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
QTRT1 Rabbit Polyclonal Antibody
orb1879736-03 100 µL

QTRT1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
QTRT1 Rabbit Polyclonal Antibody
orb1879736-04 200 µL

QTRT1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details